Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | Site Ekle Firma Ekle Site Kaydet , Web Kuyusu'nda Yerinizi Alın | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 63. |
Website meta description | A description has not been provided for this site. | The length of the meta description is 50 characters. Google recommends up to around 280-320 characters at the most. |
Website load speed | Approximately 0.8226 seconds | Website load speed is on a good level, great! But if an improvement can be made, it's always for the better. |
Rank by Alexa | 972,714 | We are not fans of the Alexa rank, but if we base our assumptions on it, the website is not that popular. |
Homepage links | Approximately 57 | A good amount of links and nothing to worry about. |
Pages linking back | We counted 54 | Such a low amount of backlinks is insufficient and either shows the website is of low quality, or does not reach a wide audience. |
Size of page HTML | 17.6KB | This is a very good result, as search engines prioritize websites that are quick to load. |
Server data | Server seems to be online. IP adress for this domain is 88.255.89.173. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
A website is not just Quantcast ranks and meta information. There is a whole lot more to it. Let's give it a proper look now, shall we?
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Similar websites | ankaraevdenevenakliyatfirmalari.com dizin.tc esamsun.com seodizin.com wmservisi.com |
While we can't speak with a hundred percent certainty, these website seem to fall into the same category as webkuyusu.com. Thus, they probably target the same audience and, likely, keywords. |
The following statistics are provided only as an approximation. We can't guarantee the numbers are absolutely correct, but we do believe they are very much within the ballpark and, as such, can give a pretty good idea about the popularity of this website.
Let's start with some telling numbers and then break it all down.
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Average visit time | 2:35 | Visitors spend a decent amount of time reading the website. |
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Date: Tue, 13 Jun 2017 01:07:50 GMT Server: X-Powered-By: PHP/5.4.45 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding,User-Agent Set-Cookie: PHPSESSID=1d646ea90d75ac72f6eaf94578d2ea86; path=/ Transfer-Encoding: chunked Content-Type: text/html |
WHOIS entry |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: WEBKUYUSU.COM Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM Sponsoring Registrar IANA ID: 303 Whois Server: whois.PublicDomainRegistry.com Referral URL: http://www.publicdomainregistry.com Name Server: NS3.REHBERHOST.NET Name Server: NS4.REHBERHOST.NET Status: ok https://icann.org/epp#ok Updated Date: 14-jun-2016 Creation Date: 14-jun-2005 Expiration Date: 14-jun-2017 >>> Last update of whois database: Wed, 19 Apr 2017 21:44:37 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: WEBKUYUSU.COM Registry Domain ID: 169808639_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2016-06-14T11:15:21Z Creation Date: 2005-06-14T06:32:13Z Registrar Registration Expiration Date: 2017-06-14T06:32:13Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: OK https://icann.org/epp#OK Registry Registrant ID: Not Available From Registry Registrant Name: RehberHOST.net Registrant Organization: RehberHOST.net Linux ve Windows Hosting Registrant Street: Ivedik Caddesi Karsiyaka Is Merkezi No: 486/214 Yenimahalle Yenimahalle 9270239231 Registrant City: Ankara Registrant State/Province: Ankara Registrant Postal Code: 06190 Registrant Country: TR Registrant Phone: +090.3123344496 Registrant Phone Ext: Registrant Fax: +090.3123344496 Registrant Fax Ext: Registrant Email: Registry Admin ID: Not Available From Registry Admin Name: RehberHOST.net Admin Organization: RehberHOST.net Linux ve Windows Hosting Admin Street: Ivedik Caddesi Karsiyaka Is Merkezi No: 486/214 Yenimahalle Yenimahalle 9270239231 Admin City: Ankara Admin State/Province: Ankara Admin Postal Code: 06190 Admin Country: TR Admin Phone: +090.3123344496 Admin Phone Ext: Admin Fax: +090.3123344496 Admin Fax Ext: Admin Email: Registry Tech ID: Not Available From Registry Tech Name: RehberHOST.net Tech Organization: RehberHOST.net Linux ve Windows Hosting Tech Street: Ivedik Caddesi Karsiyaka Is Merkezi No: 486/214 Yenimahalle Yenimahalle 9270239231 Tech City: Ankara Tech State/Province: Ankara Tech Postal Code: 06190 Tech Country: TR Tech Phone: +090.3123344496 Tech Phone Ext: Tech Fax: +090.3123344496 Tech Fax Ext: Tech Email: Name Server: ns3.rehberhost.net Name Server: ns4.rehberhost.net DNSSEC:Unsigned Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2017-04-19T21:44:54Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: REHBERHOST.NET The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is PDR Ltd. d/b/a PublicDomainRegistry.com. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms. |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for webkuyusu.com:
Here is a list of some more reports for you to check. If you found this one on webkuyusu.com useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for webkuyusu.com domain name: