Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | .:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::. | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 49. |
Website load speed | Approximately 1.8998 seconds | It takes too long to load the website – we would suggest the webmaster to look into it. |
Rank by Alexa | 951,997 | We are not fans of the Alexa rank, but if we base our assumptions on it, the website is not that popular. |
Homepage links | Approximately 19 | A good amount of links and nothing to worry about. |
Size of page HTML | 48.7KB | If it were up to us, we'd urge the webmaster to improve. The result isn't very good, you see. Just saying. |
Server data | Server seems to be online. IP adress for this domain is 103.24.202.75. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Date: Thu, 29 Jun 2017 06:14:19 GMT Server: Apache X-Powered-By: PHP/5.6.27 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=dcec1d6f0e5c808b3d2fd4fe65e006b3; path=/ Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
WHOIS entry |
---|
Domain Name: SRISUBRAHMANYASWAMYDEVALAYAMSKANDAGIRI.ORG Registry Domain ID: D162151921-LROR Registrar WHOIS Server: Registrar URL: http://www.PublicDomainRegistry.com Updated Date: 2017-04-12T04:37:57Z Creation Date: 2011-04-29T14:24:28Z Registry Expiry Date: 2018-04-29T14:24:28Z Registrar Registration Expiration Date: Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.2013775952 Reseller: Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: C137364795-LROR Registrant Name: Outline Designs Registrant Organization: Outline Designs Registrant Street: Flat No: 608, taj enclave Registrant Street: Lakdikapool Registrant City: Hyderabad Registrant State/Province: Andhra Pradesh Registrant Postal Code: 500004 Registrant Country: IN Registrant Phone: +91.04064538777 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: C137364795-LROR Admin Name: Outline Designs Admin Organization: Outline Designs Admin Street: Flat No: 608, taj enclave Admin Street: Lakdikapool Admin City: Hyderabad Admin State/Province: Andhra Pradesh Admin Postal Code: 500004 Admin Country: IN Admin Phone: +91.04064538777 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: C137364795-LROR Tech Name: Outline Designs Tech Organization: Outline Designs Tech Street: Flat No: 608, taj enclave Tech Street: Lakdikapool Tech City: Hyderabad Tech State/Province: Andhra Pradesh Tech Postal Code: 500004 Tech Country: IN Tech Phone: +91.04064538777 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: NS1.OUTLINE.CO.IN Name Server: NS2.OUTLINE.CO.IN DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2017-05-14T21:03:03Z <<< For more information on Whois status codes, please visit https://icann.org/epp Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for srisubrahmanyaswamydevalayamskandagiri.org:
Here is a list of some more reports for you to check. If you found this one on srisubrahmanyaswamydevalayamskandagiri.org useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for srisubrahmanyaswamydevalayamskandagiri.org domain name: