Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | Philadelphia Criminal Defense Lawyer Blog - Published by Philadelphia, Pennsylvania Criminal Defense and Fraud Defense Attorney Marc Neff | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 137. |
Website meta description | A description has not been provided for this site. | The length of the meta description is 50 characters. Google recommends up to around 280-320 characters at the most. |
Website load speed | Approximately 1.0466 seconds | Website load speed is on a good level, great! But if an improvement can be made, it's always for the better. |
Global rank by Quantcast | 557,024, after last update | Based on the gathered data, Quantcast does not consider this website to be popular. Take it for what it's worth. |
Homepage links | Approximately 91 | A good amount of links and nothing to worry about. |
Pages linking back | We counted 13 | Such a low amount of backlinks is insufficient and either shows the website is of low quality, or does not reach a wide audience. |
Size of page HTML | 42KB | This is a very good result, as search engines prioritize websites that are quick to load. |
Server data | Server seems to be online. IP adress for this domain is 184.106.55.79. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
A website is not just Quantcast ranks and meta information. There is a whole lot more to it. Let's give it a proper look now, shall we?
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Similar websites | nefflawoffices.com thetravislawfirm.net zarwin.com |
While we can't speak with a hundred percent certainty, these website seem to fall into the same category as philadelphiacriminaldefenselawyerblog.com. Thus, they probably target the same audience and, likely, keywords. |
QUANTCAST is very similar to Alexa, though perhaps enjoys an overall better user opinion even if, by comparison, the data processing company's rank index is smaller. The main interest of QUANTCAST is real-time audience analysis, so again the rank is based on traffic. QUANTCAST gathers this data mainly for advertising purposes of other companies. We know that, so far, QUANTCAST has ranked 128,368,205 websites, give or take a few. With all of this said, Quantcast rank is not really any more useful than that of Alexa and most similar ranking systems. Few of them, if any, take context into account and rate websites purely on traffic numbers (guesstimated, in so many cases). It's by far not the most accurate representation of a website's worth.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Server: Apache/2.4 Content-Type: text/html; charset=UTF-8 Date: Mon, 20 Nov 2017 21:22:55 GMT X-Pingback: http://philadelphiacriminaldefenselawyerblog.com/xmlrpc.php Transfer-Encoding: chunked Connection: Keep-Alive Set-Cookie: X-Mapping-cnpnknme=2C174526E62A3CEA3C194627CC3B4B31; path=/ |
WHOIS entry |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS53.DOMAINCONTROL.COM Name Server: NS54.DOMAINCONTROL.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 15-jul-2016 Creation Date: 09-aug-2007 Expiration Date: 09-aug-2017 >>> Last update of whois database: Sun, 16 Apr 2017 20:35:51 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM Registrar URL: http://www.godaddy.com Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Name Server: NS53.DOMAINCONTROL.COM Name Server: NS54.DOMAINCONTROL.COM DNSSEC: unsigned For complete domain details go to: http://who.godaddy.com/whoischeck.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database. |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for philadelphiacriminaldefenselawyerblog.com:
Here is a list of some more reports for you to check. If you found this one on philadelphiacriminaldefenselawyerblog.com useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for philadelphiacriminaldefenselawyerblog.com domain name: