Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | Tampa Bay Florida Criminal Defense Attorney - Clearwater Crime Attorney - Saint Petersburg, FL Injury Lawyer | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 108. |
Website meta description | Call (727) 286-6141 - Blake & Dorsten, P.A. is dedicated to serving our clients with a range of legal services including Criminal Defense, Crime and Injury cases. | The length of the meta description is 166 characters. Google recommends up to around 280-320 characters at the most. |
Metadata keywords | Available 24/7 - Call (727) 286-6141 - Blake & Dorsten, P.A. is dedicated to serving our clients with a range of legal services including Criminal Defense and Crime cases. | Oh. It's unexpected, to put it mildly, to see meta keywords still being used. After all, they are no longer a ranking factor and associate with spam more than anything else. |
Website load speed | Approximately 2.0775 seconds | It takes too long to load the website – we would suggest the webmaster to look into it. |
Homepage links | Approximately 89 | A good amount of links and nothing to worry about. |
Pages linking back | We counted 1 | Such a low amount of backlinks is insufficient and either shows the website is of low quality, or does not reach a wide audience. |
Size of page HTML | 28.6KB | If it were up to us, we'd urge the webmaster to improve. The result isn't very good, you see. Just saying. |
Server data | Server seems to be online. IP adress for this domain is 64.41.139.14. | The location of the server is in Mountain View, California, United States. The hosting service is provided by a known, trustworthy company. |
Status of domain | Date of registry: 2010-06-29 00:00:00 | Due to lack of data, we can't provide a meaningful insight. blakedorstenlaw.com has been registered at GODADDY.COM, LLC |
The basic overview not enough? Let's dive deeper.
A website is not just Quantcast ranks and meta information. There is a whole lot more to it. Let's give it a proper look now, shall we?
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Similar websites | pallegarlawfirm.com helpgoodpeople.com defendtampa.com floridastandyourground.org tampaflcriminaldefenselawyers.com |
While we can't speak with a hundred percent certainty, these website seem to fall into the same category as blakedorstenlaw.com. Thus, they probably target the same audience and, likely, keywords. |
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 301 Moved Permanently Date: Mon, 25 Jul 2016 12:25:51 GMT Server: Apache/2.2.3 (CentOS) Location: http://www.blakedorstenlaw.com/ Cache-Control: max-age=1 Expires: Mon, 25 Jul 2016 12:25:52 GMT Vary: Accept-Encoding Content-Length: 323 Connection: close Content-Type: text/html; charset=iso-8859-1 HTTP/1.1 200 OK Date: Mon, 25 Jul 2016 12:25:51 GMT Server: Apache/2.2.3 (CentOS) Accept-Ranges: bytes Cache-Control: max-age=1, public Expires: Mon, 25 Jul 2016 12:25:52 GMT Vary: Accept-Encoding,User-Agent Pragma: public Connection: close Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
WHOIS entry |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: BLAKEDORSTENLAW.COM Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS57.DOMAINCONTROL.COM Name Server: NS58.DOMAINCONTROL.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 07-dec-2015 Creation Date: 29-jun-2010 Expiration Date: 29-jun-2018 >>> Last update of whois database: Mon, 25 Jul 2016 12:25:47 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for blakedorstenlaw.com:
Here is a list of some more reports for you to check. If you found this one on blakedorstenlaw.com useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for blakedorstenlaw.com domain name: