Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | Modern Family Hollywood Here I Come Sweepstakes | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 47. |
Website meta description | Enter for a chance to win a trip to Hollywood, California, and attend a Modern Family table read! | The length of the meta description is 97 characters. Google recommends up to around 280-320 characters at the most. |
Website load speed | Approximately 2.1673 seconds | It takes too long to load the website – we would suggest the webmaster to look into it. |
Rank by Alexa | 951,415 | We are not fans of the Alexa rank, but if we base our assumptions on it, the website is not that popular. |
Global rank by Quantcast | 951,340, after last update | Based on the gathered data, Quantcast does not consider this website to be popular. Take it for what it's worth. |
Homepage links | Approximately 7 | Such an amount of links on a homepage might raise a question or two. |
Size of page HTML | 3.2KB | If it were up to us, we'd urge the webmaster to improve. The result isn't very good, you see. Just saying. |
Server data | Server seems to be online. IP adress for this domain is 159.135.22.126. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
QUANTCAST is very similar to Alexa, though perhaps enjoys an overall better user opinion even if, by comparison, the data processing company's rank index is smaller. The main interest of QUANTCAST is real-time audience analysis, so again the rank is based on traffic. QUANTCAST gathers this data mainly for advertising purposes of other companies. We know that, so far, QUANTCAST has ranked 163,025,196 websites, give or take a few. With all of this said, Quantcast rank is not really any more useful than that of Alexa and most similar ranking systems. Few of them, if any, take context into account and rate websites purely on traffic numbers (guesstimated, in so many cases). It's by far not the most accurate representation of a website's worth.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Server: Microsoft-IIS/8.5 X-AspNet-Version: 4.0.30319 Cache-Control: private Content-Type: text/html; charset=utf-8 Date: Mon, 12 Jun 2017 19:12:52 GMT Set-Cookie: X-Mapping-lgdkfegg=6BE9AB5F9E84B24C569BBD3444A877F8; path=/ X-Powered-By: ASP.NET Content-Length: 3231 |
WHOIS entry |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: MODERNFAMILYNIGHTLYSWEEPSTAKES.COM Registrar: MARKMONITOR INC. Sponsoring Registrar IANA ID: 292 Whois Server: whois.markmonitor.com Referral URL: http://www.markmonitor.com Name Server: DNS1.STABLETRANSIT.COM Name Server: DNS2.STABLETRANSIT.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 08-jul-2016 Creation Date: 08-aug-2014 Expiration Date: 08-aug-2017 >>> Last update of whois database: Fri, 14 Apr 2017 04:38:37 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: modernfamilynightlysweepstakes.com Registry Domain ID: 1870313490_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.markmonitor.com Registrar URL: http://www.markmonitor.com Updated Date: 2016-07-08T02:07:57-0700 Creation Date: 2014-08-08T15:21:59-0700 Registrar Registration Expiration Date: 2017-08-08T00:00:00-0700 Registrar: MarkMonitor, Inc. Registrar IANA ID: 292 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.2083895740 Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited) Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited) Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited) Registry Registrant ID: Registrant Name: Intellectual Property Department Registrant Organization: Twentieth Century Fox Film Corporation Registrant Street: P.O. Box 900, Registrant City: Beverly Hills Registrant State/Province: CA Registrant Postal Code: 90213-0900 Registrant Country: US Registrant Phone: +1.3103691000 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: Admin Name: Intellectual Property Department Admin Organization: Twentieth Century Fox Film Corporation Admin Street: P.O. Box 900, Admin City: Beverly Hills Admin State/Province: CA Admin Postal Code: 90213-0900 Admin Country: US Admin Phone: +1.3103691000 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: Tech Name: Intellectual Property Department Tech Organization: Twentieth Century Fox Film Corporation Tech Street: P.O. Box 900, Tech City: Beverly Hills Tech State/Province: CA Tech Postal Code: 90213-0900 Tech Country: US Tech Phone: +1.3103691000 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: dns2.stabletransit.com Name Server: dns1.stabletransit.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2017-04-13T21:38:57-0700 <<< The Data in MarkMonitor.com's WHOIS database is provided by MarkMonitor.com for information purposes, and to assist persons in obtaining information about or related to a domain name registration record. MarkMonitor.com does not guarantee its accuracy. By submitting a WHOIS query, you agree that you will use this Data only for lawful purposes and that, under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail (spam); or (2) enable high volume, automated, electronic processes that apply to MarkMonitor.com (or its systems). MarkMonitor.com reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. MarkMonitor is the Global Leader in Online Brand Protection. MarkMonitor Domain Management(TM) MarkMonitor Brand Protection(TM) MarkMonitor AntiPiracy(TM) MarkMonitor AntiFraud(TM) Professional and Managed Services Visit MarkMonitor at http://www.markmonitor.com Contact us at +1.8007459229 In Europe, at +44.02032062220 For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for modernfamilynightlysweepstakes.com:
Here is a list of some more reports for you to check. If you found this one on modernfamilynightlysweepstakes.com useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for modernfamilynightlysweepstakes.com domain name: