Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | Village of Gays Mills - Village of Gays Mills | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 45. |
Website meta description | Official site. Includes area activities, events, business directory, lodging information, and map. | The length of the meta description is 98 characters. Google recommends up to around 280-320 characters at the most. |
Metadata keywords | Gays Mills, Wisconsin, Driftless Wisconsin, Driftless Area, Driftless, Ocooch Mountains, Apple Fest, Apple Festival, Folk Festival, Folk Fest, Floods, Hills, Mountains, WI, Wisc., | Oh. It's unexpected, to put it mildly, to see meta keywords still being used. After all, they are no longer a ranking factor and associate with spam more than anything else. |
Website load speed | Approximately 1.5341 seconds | It takes too long to load the website – we would suggest the webmaster to look into it. |
Rank by Alexa | 3,209,375 | We are not fans of the Alexa rank, but if we base our assumptions on it, the website is not that popular. |
Homepage links | Approximately 7 | Such an amount of links on a homepage might raise a question or two. |
Pages linking back | We counted 39 | Such a low amount of backlinks is insufficient and either shows the website is of low quality, or does not reach a wide audience. |
Size of page HTML | 53.2KB | If it were up to us, we'd urge the webmaster to improve. The result isn't very good, you see. Just saying. |
Server data | Server seems to be online. IP adress for this domain is 199.34.228.55. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
A website is not just Quantcast ranks and meta information. There is a whole lot more to it. Let's give it a proper look now, shall we?
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Categories of the website | Regional North America United States Wisconsin Localities G Gays Mills |
These are not only the possible categories the website falls into, but also areas of interest of the main target audience. |
Similar websites | gaysmillsorchardridge.com sunriseapples.com gaysmillsapplefestfleamarket.com kickapoo-orchard.com gaysmillslibrary.org |
While we can't speak with a hundred percent certainty, these website seem to fall into the same category as gaysmills.org. Thus, they probably target the same audience and, likely, keywords. |
The following statistics are provided only as an approximation. We can't guarantee the numbers are absolutely correct, but we do believe they are very much within the ballpark and, as such, can give a pretty good idea about the popularity of this website.
Let's start with some telling numbers and then break it all down.
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Average visit time | 1:47 | Visitors spend a decent amount of time reading the website. |
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Date: Thu, 23 Nov 2017 20:31:10 GMT Server: Apache Set-Cookie: is_mobile=0; path=/; domain=www.gaysmills.org Set-Cookie: language=en; expires=Thu, 07-Dec-2017 20:31:10 GMT; Max-Age=1209600; path=/ Cache-Control: private ETag: W/"a5fe24704c3c0cda902098948f8e1065" Vary: Accept-Encoding,User-Agent X-Host: pages10.sf2p.intern.weebly.net X-UA-Compatible: IE=edge,chrome=1 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for gaysmills.org:
Here is a list of some more reports for you to check. If you found this one on gaysmills.org useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for gaysmills.org domain name: