Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | Natural Wines from Deep Creek Cellars - Home | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 44. |
Website meta description | Family owned winery and vineyard in the Appalachians, making red, white, and fortified wines. Includes descriptions of the products and the property. Located in Friendsville. | The length of the meta description is 174 characters. Google recommends up to around 280-320 characters at the most. |
Website load speed | Approximately 0.5996 seconds | Website load speed is on a good level, great! But if an improvement can be made, it's always for the better. |
Rank by Alexa | 11,097,893 | We are not fans of the Alexa rank, but if we base our assumptions on it, the website is not that popular. |
Homepage links | Approximately 10 | Such an amount of links on a homepage might raise a question or two. |
Pages linking back | We counted 30 | Such a low amount of backlinks is insufficient and either shows the website is of low quality, or does not reach a wide audience. |
Size of page HTML | 24.9KB | This is a very good result, as search engines prioritize websites that are quick to load. |
Server data | Server seems to be online. IP adress for this domain is 65.254.227.224. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
A website is not just Quantcast ranks and meta information. There is a whole lot more to it. Let's give it a proper look now, shall we?
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Categories of the website | Recreation Food Drink Wine United States Maryland Regional North America United States Maryland Localities F Friendsville Business and Economy |
These are not only the possible categories the website falls into, but also areas of interest of the main target audience. |
Similar websites | discoverycenterdcl.com deepcreekwinefest.com hartzellhouse.com deepcreeklakefamilyactivities.com thedeepcreekrestaurant.com |
While we can't speak with a hundred percent certainty, these website seem to fall into the same category as deepcreekcellars.com. Thus, they probably target the same audience and, likely, keywords. |
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Date: Tue, 21 Nov 2017 19:00:09 GMT Content-Type: text/html; charset=utf-8 Content-Length: 25462 Connection: keep-alive Server: Apache/2 Set-Cookie: is_mobile=0; path=/; domain=deepcreekcellars.com Last-Modified: Tue, 21 Nov 2017 17:41:13 GMT ETag: "6376-55e81b58c5b3c" Accept-Ranges: bytes Cache-Control: max-age=3600 Expires: Tue, 21 Nov 2017 20:00:09 GMT Age: 0 |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for deepcreekcellars.com:
Here is a list of some more reports for you to check. If you found this one on deepcreekcellars.com useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for deepcreekcellars.com domain name: