Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | شركة كشف تسربات المياه بالرياض (الموقع للايجار | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 46. |
Website meta description | A description has not been provided for this site. | The length of the meta description is 50 characters. Google recommends up to around 280-320 characters at the most. |
Metadata keywords | شركة, كشف, تسربات, تسرب,ماء,بالرياض, افضل, أحدث, سائل,إصلاح, بالضمان,إصلاح, تسربات, المياه, كشفو تسربات, المياه, الرياض, بدون تكسير, باحدث, اجهزة, في, كشف تسربو الماء, في الجدار,الحمامات, السقف,الرياض, | Oh. It's unexpected, to put it mildly, to see meta keywords still being used. After all, they are no longer a ranking factor and associate with spam more than anything else. |
Website load speed | Approximately 5.6953 seconds | It takes too long to load the website – we would suggest the webmaster to look into it. |
Rank by Alexa | 977,208 | We are not fans of the Alexa rank, but if we base our assumptions on it, the website is not that popular. |
Homepage links | Approximately 31 | A good amount of links and nothing to worry about. |
Pages linking back | We counted 2 | Such a low amount of backlinks is insufficient and either shows the website is of low quality, or does not reach a wide audience. |
Size of page HTML | 15.7KB | If it were up to us, we'd urge the webmaster to improve. The result isn't very good, you see. Just saying. |
Server data | Server seems to be online. IP adress for this domain is 149.56.3.122. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Server: nginx Date: Wed, 24 May 2017 17:00:06 GMT Content-Type: text/html Content-Length: 15948 Connection: keep-alive Vary: Accept-Encoding Last-Modified: Fri, 07 Oct 2016 19:37:08 GMT Expires: Wed, 24 May 2017 17:00:07 GMT Cache-Control: max-age=1 X-Cache-Status: MISS X-Server-Powered-By: Engintron Pragma: public Cache-Control: public Vary: Accept-Encoding Accept-Ranges: bytes |
WHOIS entry |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: COMPANYDETECTLEAKSWATERINRIYADH.COM Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS1.NAKLAFSH.COM Name Server: NS2.NAKLAFSH.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 09-dec-2016 Creation Date: 05-oct-2016 Expiration Date: 05-oct-2017 >>> Last update of whois database: Sat, 27 May 2017 16:25:13 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: companydetectleakswaterinriyadh.com Registrar URL: http://www.godaddy.com Registrant Name: HoStY-HoSt.CoM EG Registrant Organization: HoStY-HoSt.CoM.EG Name Server: NS1.NAKLAFSH.COM Name Server: NS2.NAKLAFSH.COM DNSSEC: unsigned For complete domain details go to: http://who.godaddy.com/whoischeck.aspx?domain=companydetectleakswaterinriyadh.com The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database. |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for companydetectleakswaterinriyadh.com:
Here is a list of some more reports for you to check. If you found this one on companydetectleakswaterinriyadh.com useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for companydetectleakswaterinriyadh.com domain name: