Perhaps the most relevant statistics data that we could gather is presented here:
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Site title (meta) | VW Campervan Hire Scotland | VW Campervan Rental Scotland | Sticking to between 50-60 characters for meta title length is a good idea. The length of this website's meta title is 57. |
Website meta description | Classic VW campervan rental company. Includes details of the vehicles, prices and availability. | The length of the meta description is 95 characters. Google recommends up to around 280-320 characters at the most. |
Metadata keywords | VW Campervan Hire Scotland, VW Campervan Rental Scotland, VW Camper Van Hire Scotland, VW Camper Van Rental Scotland | Oh. It's unexpected, to put it mildly, to see meta keywords still being used. After all, they are no longer a ranking factor and associate with spam more than anything else. |
Website load speed | Approximately 0.6501 seconds | Website load speed is on a good level, great! But if an improvement can be made, it's always for the better. |
Rank by Alexa | 11,413,963 | We are not fans of the Alexa rank, but if we base our assumptions on it, the website is not that popular. |
Homepage links | Approximately 39 | A good amount of links and nothing to worry about. |
Pages linking back | We counted 8 | Such a low amount of backlinks is insufficient and either shows the website is of low quality, or does not reach a wide audience. |
Size of page HTML | 22.2KB | This is a very good result, as search engines prioritize websites that are quick to load. |
Server data | Server seems to be online. IP adress for this domain is 185.23.116.192. | Due to lack of data, we can't provide a meaningful insight. |
The basic overview not enough? Let's dive deeper.
A website is not just Quantcast ranks and meta information. There is a whole lot more to it. Let's give it a proper look now, shall we?
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Categories of the website | Regional Europe United Kingdom Scotland Borders Selkirk Travel and Tourism |
These are not only the possible categories the website falls into, but also areas of interest of the main target audience. |
Similar websites | kombicampers.co.uk scoobycampers.com sunnysideclassicvwcamperrentals.co.uk escapecampers.co.uk morayfirthcamperandcaravanhire.co.uk |
While we can't speak with a hundred percent certainty, these website seem to fall into the same category as classic-camper-holidays.co.uk. Thus, they probably target the same audience and, likely, keywords. |
The following statistics are provided only as an approximation. We can't guarantee the numbers are absolutely correct, but we do believe they are very much within the ballpark and, as such, can give a pretty good idea about the popularity of this website.
Let's start with some telling numbers and then break it all down.
Data type/Website parameter | Status or value | Our findings |
---|---|---|
Average visit time | 6:04 | This is a good amount of time for visitors to spend on the website on average, great result! |
Alexa, perhaps the oldest ranking system of its sort, bases it's website rating on approximated number of visitors of a specific page. In other words, the more visitors, the higher the global and local ranks. As of recently, Alexa has well over four million websites ranked. Having said all that, Alexa rank should be taken with a grain of salt. Or a massive bucketload. In other words, we think it to be greatly overrated, as it never takes into account how popular a website is within its niche.
What is a server? It's basically a physical storage device (one that, sometimes, makes up several virtual servers for the cheaper shared hosting) that holds all the files and databases associated with a specific website or websites. Obviously, it's a touch more complicated than that (servers also have processors), but the essence is quite simple - your browser contacts the server, which then sends all the neccessary information and files to your computer. Each physical server has a unique IP address assigned to it, too, for easy recognition.
If you need more raw data, here's what we managed to gather:
Header information |
---|
HTTP/1.1 200 OK Date: Wed, 18 Oct 2017 06:43:04 GMT Server: Apache X-Powered-By: PHP/5.4.45 Set-Cookie: zp_user_auth=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/ Set-Cookie: zenphoto_ssl=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/ Last-Modified: Wed, 18 Oct 2017 06:43:05 GMT Connection: close Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
Typos are not uncommon, not even with website addresses. More than that, the more popular the website, the more typos there tend to happen. We have gathered and generated the following list of most frequently encountered mistypes for classic-camper-holidays.co.uk:
Here is a list of some more reports for you to check. If you found this one on classic-camper-holidays.co.uk useful, the following list will be of interest to you, too:
This list contains 370 top level domain variantions for classic-camper-holidays.co.uk domain name: